DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2A:CG33862 and H2al1a

DIOPT Version :9

Sequence 1:NP_001027381.1 Gene:His2A:CG33862 / 3772278 FlyBaseID:FBgn0053862 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001104507.1 Gene:H2al1a / 100042922 MGIID:3714114 Length:105 Species:Mus musculus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:55/96 - (57%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRII 79
            ::||.|..|.|.:  :.|.||:..::.|:.:.|..:|.:|:|||.:.:|||||..|:...:.||.
Mouse    13 RTRSQRGELPFSL--VDRFLREEFHSSRLSSSALSFLTSVLEYLTSNILELAGEVAQTTGRKRIA 75

  Fly    80 PRHLQLAIRNDEELNKLLSGVTIAQGGVLPN 110
            |..::|.::|:|:|.:|..     .||...|
Mouse    76 PEDVRLVVQNNEQLRQLFK-----PGGTSVN 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2A:CG33862NP_001027381.1 PTZ00017 16..124 CDD:185399 32/95 (34%)
H2al1aNP_001104507.1 H2A <50..>94 CDD:330514 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5262
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.