DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and AT1G08170

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_172295.1 Gene:AT1G08170 / 837338 AraportID:AT1G08170 Length:243 Species:Arabidopsis thaliana


Alignment Length:126 Identity:68/126 - (53%)
Similarity:92/126 - (73%) Gaps:8/126 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKT----SGKAAKKAGKAQKNITKTDKKKKRKRK----ESYAIYIYKVLKQVHPDTGISSKAMS 58
            ||:|    |....||..|.:|......||||:||.    :.|..|:|||:||||||.||:||||:
plant   110 PPETPASKSEGTLKKTDKVEKKQENKKKKKKKKRDDLAGDEYRRYVYKVMKQVHPDLGITSKAMT 174

  Fly    59 IMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY 119
            ::|.|:.|:|||||.||:||:.|.||.|::||||:.||||:|||||::|||:||:|||:.:
plant   175 VVNMFMGDMFERIAQEAARLSDYTKRRTLSSREIEAAVRLVLPGELSRHAVAEGSKAVSNF 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 54/87 (62%)
AT1G08170NP_172295.1 Histone 87..215 CDD:278551 54/104 (52%)
H2B 106..235 CDD:304987 68/124 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.