DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and XB5731801

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_002933998.2 Gene:XB5731801 / 733561 XenbaseID:XB-GENE-5731802 Length:98 Species:Xenopus tropicalis


Alignment Length:88 Identity:38/88 - (43%)
Similarity:50/88 - (56%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KKAGKAQKNITK-TDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAE 74
            ||...|..|:.: |..|.|.|.|..|:.:||:||||   :...||.|.....|...:....||.|
 Frog     6 KKMRSAGNNMPQSTLGKGKVKSKGRYSSFIYRVLKQ---NQRKSSFASLSKESTGKETCLCIADE 67

  Fly    75 ASRLAHYNKRSTITSREIQTAVR 97
            |:||:.||||.|||.:|||:||:
 Frog    68 AARLSLYNKRKTITCQEIQSAVK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 29/65 (45%)
XB5731801XP_002933998.2 H2B 2..>92 CDD:355063 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.