DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and H2bw2

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_081343.1 Gene:H2bw2 / 69389 MGIID:1916639 Length:224 Species:Mus musculus


Alignment Length:123 Identity:57/123 - (46%)
Similarity:86/123 - (69%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKAGKAQKNITKTDKKKK--RKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVN 65
            |:......::.....::|.:.:::.:  |:||.|:|||..||||.:|....:|.::::|::|||.
Mouse   102 PEQEKPEVQRRRSLHQSIREDERRARLIRRRKNSFAIYFPKVLKNIHVGLSLSQRSVNILDSFVK 166

  Fly    66 DIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |:|||||:|||.||...:.|||.|||||||:||||||||.:.||:|||.|:.:|.|:|
Mouse   167 DMFERIASEASFLARQARNSTINSREIQTAIRLLLPGELCRRAVAEGTMAMVRYISNK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 50/87 (57%)
H2bw2NP_081343.1 H2B 133..222 CDD:304987 51/88 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.