DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and LOC684444

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_003749220.1 Gene:LOC684444 / 684444 RGDID:1590323 Length:123 Species:Rattus norvegicus


Alignment Length:89 Identity:46/89 - (51%)
Similarity:64/89 - (71%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRL 98
            :|::||.:|||:|.|..||||..:.|||..:||||||||.||.:..:..||.|:||.:||.||.:
  Rat    35 NYSLYINRVLKEVVPKRGISSHTVDIMNLMINDIFERIATEACQRMNLRKRCTLTSEDIQKAVYM 99

  Fly    99 LLPGELAKHAVSEGTKAVTKYTSS 122
            |:|.:|||.||:.|:|||.::..|
  Rat   100 LMPKKLAKLAVTFGSKAVHRFIHS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 45/86 (52%)
LOC684444XP_003749220.1 H2B <36..120 CDD:304987 45/83 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.