DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and H2bc18

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_783597.2 Gene:H2bc18 / 319189 MGIID:2448413 Length:126 Species:Mus musculus


Alignment Length:128 Identity:103/128 - (80%)
Similarity:108/128 - (84%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTD----KKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..|.||..|  |.:||..    ||:||.|||||::|:||||||||||||||||||.||
Mouse     1 MPDPAKSAPAPKKGSK--KAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    64 NSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 82/87 (94%)
H2bc18NP_783597.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 16/36 (44%)
H2B 28..124 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm42638
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.