DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and Hist1h2bl

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_225384.1 Gene:Hist1h2bl / 306969 RGDID:1308088 Length:126 Species:Rattus norvegicus


Alignment Length:122 Identity:101/122 - (82%)
Similarity:105/122 - (86%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVND 66
            |.|.|.||..||.|      |..||:||.|||||::|:||||||||||||||||||.||||||||
  Rat    11 PKKGSKKAVTKAQK------KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVND 69

  Fly    67 IFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    70 IFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 82/87 (94%)
Hist1h2blXP_225384.1 Histone 5..102 CDD:278551 75/96 (78%)
H2B 28..124 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4523
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3779
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm44705
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.