DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and H2bc1

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_072169.1 Gene:H2bc1 / 24829 RGDID:3855 Length:127 Species:Rattus norvegicus


Alignment Length:128 Identity:104/128 - (81%)
Similarity:109/128 - (85%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKA---AKKAGKAQKNITKTDKKKKRKRK----ESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            |:.|.|.   :||..|  |.:|||.||:.||||    |||:||||||||||||||||||||||||
  Rat     2 PEVSAKGTTISKKGFK--KAVTKTQKKEGRKRKRCREESYSIYIYKVLKQVHPDTGISSKAMSIM 64

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||.|||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    65 NSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 84/87 (97%)
H2bc1NP_072169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 14/31 (45%)
Histone 5..103 CDD:278551 77/99 (78%)
H2B 11..126 CDD:304987 98/116 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4523
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3779
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm44705
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.