DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33886 and H2BE1

DIOPT Version :9

Sequence 1:NP_001027340.1 Gene:His2B:CG33886 / 3772271 FlyBaseID:FBgn0053886 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001356054.2 Gene:H2BE1 / 114483833 HGNCID:53833 Length:122 Species:Homo sapiens


Alignment Length:117 Identity:82/117 - (70%)
Similarity:100/117 - (85%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERI 71
            |:..:..|:..::......||:.:|||||::||||||||||||.|||:||||||||||||:||::
Human     6 GQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQL 70

  Fly    72 AAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |.||:|||.|:.|:|:||||:|||||||||||||||||||||||||||||||
Human    71 ACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33886NP_001027340.1 H2B 33..121 CDD:197718 72/87 (83%)
H2BE1NP_001356054.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 4/23 (17%)
H2B 32..120 CDD:197718 72/87 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.