DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33868 and H2BC1

DIOPT Version :9

Sequence 1:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_733759.1 Gene:H2BC1 / 255626 HGNCID:18730 Length:127 Species:Homo sapiens


Alignment Length:126 Identity:100/126 - (79%)
Similarity:109/126 - (86%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKAGKA-QKNITKTD----KKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNS 62
            |:.|.|.|..:.|. :|.:.||.    ||:||.|||||:||||||||||||||||||||||||||
Human     2 PEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNS 66

  Fly    63 FVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||.|||||||:||||||||:|||||:|||||||||||||||||||||||||||||||||||
Human    67 FVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 82/87 (94%)
H2BC1NP_733759.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 12/33 (36%)
H2B 29..125 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4650
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3871
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm40568
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.