powered by:
Protein Alignment His2B:CG33874 and Tmsb15l
DIOPT Version :9
Sequence 1: | NP_001027370.1 |
Gene: | His2B:CG33874 / 3772264 |
FlyBaseID: | FBgn0053874 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997150.1 |
Gene: | Tmsb15l / 399591 |
MGIID: | 3026988 |
Length: | 80 |
Species: | Mus musculus |
Alignment Length: | 40 |
Identity: | 10/40 - (25%) |
Similarity: | 14/40 - (35%) |
Gaps: | 8/40 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 PKTSGKAAKKA--------GKAQKNITKTDKKKKRKRKES 34
|....|.:.|. .||:...|.|:.|.....||:
Mouse 30 PSNENKMSDKPDLSEVETFDKAKLKKTNTEVKNTLPSKET 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1744 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.