DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33874 and H2bc9

DIOPT Version :9

Sequence 1:NP_001027370.1 Gene:His2B:CG33874 / 3772264 FlyBaseID:FBgn0053874 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_835504.1 Gene:H2bc9 / 319182 MGIID:2448387 Length:126 Species:Mus musculus


Alignment Length:129 Identity:104/129 - (80%)
Similarity:108/129 - (83%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
            || |..|..|.||..     ||||   |..||:||.|||||::|:||||||||||||||||||.|
Mouse     1 MPEPAKSAPAPKKGSKKALTKAQK---KDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGI 62

  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33874NP_001027370.1 H2B 33..121 CDD:197718 82/87 (94%)
H2bc9NP_835504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 17/37 (46%)
Histone 3..102 CDD:278551 76/101 (75%)
H2B 28..124 CDD:197718 88/95 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm42638
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.