DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33874 and htb1

DIOPT Version :9

Sequence 1:NP_001027370.1 Gene:His2B:CG33874 / 3772264 FlyBaseID:FBgn0053874 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_588181.1 Gene:htb1 / 2539523 PomBaseID:SPCC622.09 Length:126 Species:Schizosaccharomyces pombe


Alignment Length:120 Identity:87/120 - (72%)
Similarity:105/120 - (87%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTSGKAAKKAGKAQKNITKT-DKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDI 67
            |.:.||  .||||.::..|: |||:.:.|||:|:.||||||||||||||||::||.|:|||||||
pombe     7 KPASKA--PAGKAPRDTMKSADKKRGKNRKETYSSYIYKVLKQVHPDTGISNQAMRILNSFVNDI 69

  Fly    68 FERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            |||||.|||:||.|||:|||:||||||||||:||||||||||:||||:||||:||
pombe    70 FERIATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTKYSSS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33874NP_001027370.1 H2B 33..121 CDD:197718 72/87 (83%)
htb1NP_588181.1 H2B 27..123 CDD:197718 76/95 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1446
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I1214
OMA 1 1.010 - - QHG53922
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - oto100666
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - LDO PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.