DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33874 and AgaP_AGAP003912

DIOPT Version :9

Sequence 1:NP_001027370.1 Gene:His2B:CG33874 / 3772264 FlyBaseID:FBgn0053874 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_318364.5 Gene:AgaP_AGAP003912 / 1278747 VectorBaseID:AGAP003912 Length:91 Species:Anopheles gambiae


Alignment Length:91 Identity:87/91 - (95%)
Similarity:87/91 - (95%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 YAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAE--ASRLAHYNKRSTITSREIQTAVR 97
            |||||||||||||||||||||||||||||||||||||||.  |||||||||||||||||||||||
Mosquito     1 YAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAALLASRLAHYNKRSTITSREIQTAVR 65

  Fly    98 LLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||||||||||||||.|||||||
Mosquito    66 LLLPGELAKHAVSEGTKAATKYTSSK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33874NP_001027370.1 H2B 33..121 CDD:197718 83/87 (95%)
AgaP_AGAP003912XP_318364.5 H2B <1..90 CDD:304987 84/88 (95%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.