DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33874 and H2B_ANOGA_b

DIOPT Version :9

Sequence 1:NP_001027370.1 Gene:His2B:CG33874 / 3772264 FlyBaseID:FBgn0053874 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_307082.2 Gene:H2B_ANOGA_b / 1268522 VectorBaseID:AGAP012710 Length:124 Species:Anopheles gambiae


Alignment Length:124 Identity:119/124 - (95%)
Similarity:122/124 - (98%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGKAAKKAGKAQKNITKTDKKKKRK-RKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFV 64
            |.||||||||||:|||||||:|:||||||| ||||||||||||||||||||||||||||||||||
Mosquito     1 MAPKTSGKAAKKSGKAQKNISKSDKKKKRKTRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFV 65

  Fly    65 NDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mosquito    66 NDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33874NP_001027370.1 H2B 33..121 CDD:197718 87/87 (100%)
H2B_ANOGA_bXP_307082.2 H2B 34..122 CDD:197718 87/87 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 170 1.000 Domainoid score I7809
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128594
Inparanoid 1 1.050 227 1.000 Inparanoid score I5875
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm49793
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.