powered by:
Protein Alignment His2B:CG33874 and AgaP_AGAP012555
DIOPT Version :9
Sequence 1: | NP_001027370.1 |
Gene: | His2B:CG33874 / 3772264 |
FlyBaseID: | FBgn0053874 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024667067.1 |
Gene: | AgaP_AGAP012555 / 1268295 |
VectorBaseID: | AGAP012555 |
Length: | 94 |
Species: | Anopheles gambiae |
Alignment Length: | 59 |
Identity: | 57/59 - (96%) |
Similarity: | 59/59 - (100%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 KESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSR 90
::|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mosquito 3 RQSYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSR 61
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
His2B:CG33874 | NP_001027370.1 |
H2B |
33..121 |
CDD:197718 |
57/58 (98%) |
AgaP_AGAP012555 | XP_024667067.1 |
Histone |
3..>61 |
CDD:329110 |
55/57 (96%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1744 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.