DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33874 and si:dkey-261m9.19

DIOPT Version :9

Sequence 1:NP_001027370.1 Gene:His2B:CG33874 / 3772264 FlyBaseID:FBgn0053874 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_001923636.1 Gene:si:dkey-261m9.19 / 100005210 ZFINID:ZDB-GENE-131121-76 Length:124 Species:Danio rerio


Alignment Length:125 Identity:102/125 - (81%)
Similarity:107/125 - (85%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PKTSGKAAKKAGKAQKNITKT----DKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSF 63
            |:.:..|.||..|  |.:|||    .||:||.||||||||:||||||||||||||||||.|||||
Zfish     2 PEPAKTAPKKGSK--KAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSF 64

  Fly    64 VNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||.|||.||||||||||||||||||||||||||||||||||||||||||||||
Zfish    65 VNDIFERIAGEASCLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33874NP_001027370.1 H2B 33..121 CDD:197718 83/87 (95%)
si:dkey-261m9.19XP_001923636.1 H2B 26..122 CDD:197718 89/95 (94%)
Histone <26..100 CDD:278551 67/73 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4585
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3832
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm24418
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.