DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33626 and CG33914

DIOPT Version :10

Sequence 1:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:78 Identity:17/78 - (21%)
Similarity:32/78 - (41%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IKVYIKISTR----FKSTTLYRKFF-DITFDGCRVISDMVQGTMVSNMFNAVVKSSNQPRKCPVN 119
            |::|.::.||    ..:.:.::.|. .:..|.||...:. ...:...:|..:...:|....||..
  Fly    72 IEIYFQLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNH-HNHLARMVFEFIDGHTNMNHTCPYT 135

  Fly   120 KGTIYYHNISIED 132
            |...    |||:|
  Fly   136 KEKY----ISIDD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33626NP_001027405.2 DUF1091 76..153 CDD:472716 13/58 (22%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 13/62 (21%)

Return to query results.
Submit another query.