DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33626 and CG33922

DIOPT Version :9

Sequence 1:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:43/165 - (26%)
Similarity:71/165 - (43%) Gaps:27/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILILIHV----FHYTEAKRRLRWDCFDCQMGPHYADQMTCQIGGTRRS--LLNVELKLL-TELD 58
            :.|..||:    ..:|..|      |  ..:.|.:|....|.:....|:  ..::::||| |.:.
  Fly    12 IFLFTIHLVICKLEFTNIK------C--VTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVS 68

  Fly    59 QIKVYIKISTRFKSTTLYRKF-FDITFDGCRVISDMVQGTMVSNMFNAVVKSSNQPRKCP----- 117
            .:|  |.|:| |:....|:.| :::|.||||.........:.|..||.....||....||     
  Fly    69 NVK--INIAT-FQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDI 130

  Fly   118 -VNKGTIYYHNISIEDALPMFVPSAQLFIQIDFYA 151
             ::|.:|.:.|..:.:.||  ||......:.|:||
  Fly   131 ILDKVSISHANTQVTNVLP--VPHGNYLYRADWYA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 24/84 (29%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.