DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG34260

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:69 Identity:17/69 - (24%)
Similarity:30/69 - (43%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VGNSKSFQSLFSTSIDVCNIVNAA-KINLFKKWYKNLLKYGNFLRQCPLNASHYY-LRDWQFGEG 144
            :...||..::....||.|..:.:. :.|:..|.:|.|....|....||::....| :|::.|...
  Fly    77 IKKDKSRMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISD 141

  Fly   145 LVPP 148
            ..||
  Fly   142 EFPP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 15/63 (24%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.