DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG13589

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:124 Identity:31/124 - (25%)
Similarity:41/124 - (33%) Gaps:37/124 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSLFSTSIDVCNIVNA-----AKI 107
            |.||......|:|.|.:.|              :....|.|  ||..:.|.|..:..     |||
  Fly    60 NATFIEPAKNIYLHMKMMK--------------KANGYKPF--LFDYTFDACEFMRRRNQPFAKI 108

  Fly   108 --NLFKKW--------YKNLLKYGNFLR---QCPLNASHY-YLRDWQFGEGLVPPFITS 152
              |:.|..        |:.|....:|..   ..||.:..| .|.||.|  ...|.|.|:
  Fly   109 VWNMIKNVSTVNHTCPYEGLQMLSDFHHIDVPVPLPSGDYLLLLDWIF--DFKPQFATN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 23/84 (27%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 24/87 (28%)

Return to query results.
Submit another query.