DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33923

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:49 Identity:14/49 - (28%)
Similarity:21/49 - (42%) Gaps:3/49 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLK-YGNFLRQCP 128
            |:...|.|  |::.:||.|......|.|...::..:..| |.|....||
  Fly    79 RLNGYKPF--LYNVTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 12/42 (29%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 14/49 (29%)

Return to query results.
Submit another query.