DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33658

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:164 Identity:36/164 - (21%)
Similarity:60/164 - (36%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IAGESRFNRKY--------------FENFTFTIRNDKI------FLD------MYLRK-----PL 68
            :.|..:.||:|              |.||..|.....:      ||.      .||..     .|
  Fly     5 VRGYKQINRQYTIAFTKTQIYSHIEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL 69

  Fly    69 VRGWRARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLK-YGNFLRQCPLNAS 132
            :...:.......::...|.|  |::.:||.|..:...|.|:..|::.:.:: ..|....||.|  
  Fly    70 LNSLKVNFGLHQQINGYKPF--LYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYN-- 130

  Fly   133 HYYLRDWQFGEGL---VP---PFITSGSYRLETY 160
            |..:.:....|.:   :|   ||.| |:|..:||
  Fly   131 HDIIMEKLTSETINSRLPKTLPFPT-GNYMFQTY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 22/80 (28%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.