DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33769

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:166 Identity:46/166 - (27%)
Similarity:93/166 - (56%) Gaps:0/166 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLAIALFSIRAEGSVKFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRV 82
            |:.:.:...::...:.|.||:..:||..|.||:..|...|:.:||.|...|.:|.:|.|.|..|:
  Fly    13 CVVVTVVIKQSGPRMTFRAGDCTYNRSTFSNFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRL 77

  Fly    83 GNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLRDWQFGEGLVP 147
            ..:|.:||::...::.|.::..::.:::::|:.::||.|||...||:...:|||..|......||
  Fly    78 TKAKPYQSVYQHDMNYCALIKGSQESIYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLDANNVP 142

  Fly   148 PFITSGSYRLETYNFFGKYKGKDEDFIMSCTADAII 183
            .|:..|.||:....::|::|....:.::.|:.:|::
  Fly   143 SFLYLGDYRISGSFYYGRFKKHLYNPLLECSVEAVL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 23/89 (26%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463896
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.