DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33771

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:150 Identity:63/150 - (42%)
Similarity:97/150 - (64%) Gaps:0/150 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSLFSTSIDV 98
            |:.|.|.:|.|||:|||.||.|:.:.:||:|.:|:.||::|.:|...|:.|:|:|||:||...||
  Fly    27 FVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAHVDILLRLANAKNFQSMFSQKSDV 91

  Fly    99 CNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLRDWQFGEGLVPPFITSGSYRLETYNFF 163
            |.:.::.|.:|||.|:|::.|..||:..||:...|||:.||:.|..:...|:..|.||.:...|:
  Fly    92 CAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLTFFY 156

  Fly   164 GKYKGKDEDFIMSCTADAII 183
            |||..|..:..:|.|.|||:
  Fly   157 GKYGTKLFEEALSLTIDAIL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 35/89 (39%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.