DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33784

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:90 Identity:23/90 - (25%)
Similarity:37/90 - (41%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LFSTSIDVCNIVNAAKINLFKKW-YKNLLKYGNFLRQCPLN----ASHYYLRDWQFGEGLVPPFI 150
            ||:.::|||:.:...|...|... |..:..:.|....||.|    .:...|.|....:..||   
  Fly    90 LFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISKAPVP--- 151

  Fly   151 TSGSYRLETYNFF----GKYKGKDE 171
             :|.|:|   .|.    |.::|:.|
  Fly   152 -NGFYKL---RFIVKTDGVWRGEVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 23/90 (26%)
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 18/70 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.