DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33647

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:79 Identity:23/79 - (29%)
Similarity:40/79 - (50%) Gaps:10/79 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SFQSLFSTS-IDVCNIVNAAKIN-LFKKWYKNLLKYGNFLRQCPLNAS-HYYLRDWQFGEGLVPP 148
            |:.:.|::| :|.|.::::.:.: ||:.....|.:..||..||||..: .||.:.:......:| 
  Fly    85 SYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVNSKFIP- 148

  Fly   149 FITSGSYRLETYNF 162
                 ||..|| ||
  Fly   149 -----SYMPET-NF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 22/78 (28%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 18/67 (27%)

Return to query results.
Submit another query.