DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33767

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:175 Identity:64/175 - (36%)
Similarity:106/175 - (60%) Gaps:8/175 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCLAIALFSIRAEGSVKFI--------AGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWR 73
            |.::|.:..:....|:.|:        ||:|.|:..||||||..|:|:.:|:||...||:.||.:
  Fly    11 LDISIEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLK 75

  Fly    74 ARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLRD 138
            ..|:.:..:...:|:|.||:..:|.|.:|::.:.||||.|:.::||:|||:..||:.|.||:|||
  Fly    76 VLLNTQISLDKGRSYQRLFAHILDTCGVVSSVRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRD 140

  Fly   139 WQFGEGLVPPFITSGSYRLETYNFFGKYKGKDEDFIMSCTADAII 183
            |:....|||.::..|.|.:..:.||||:|.|.|:|.:.....|::
  Fly   141 WKLDSHLVPHYMLPGDYCITAHFFFGKHKSKQEEFFLDLEVYALL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 38/89 (43%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 38/89 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.