DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33922

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:166 Identity:33/166 - (19%)
Similarity:53/166 - (31%) Gaps:59/166 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LAIALFSIRAE------GSVKFIAGESRF-----------NR--KYFENFTFTIRNDKIFLDMYL 64
            |:|.||:|...      .::|.:..:..|           ||  ||:.            |.:.|
  Fly    10 LSIFLFTIHLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYS------------LKVKL 62

  Fly    65 RKPLVRGWRARLDFRTRVGNSKSFQSLFSTSIDVCNIVNAAKINLFKKWYKNLLK-YGNFLRQCP 128
            .|..|...:..:....|:...|.|  |::.::|.|......:.|....::.|..| |.|....||
  Fly    63 LKTPVSNVKINIATFQRLNGYKPF--LYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP 125

  Fly   129 ---------LNASH----------------YYLRDW 139
                     ::.||                .|..||
  Fly   126 YDHDIILDKVSISHANTQVTNVLPVPHGNYLYRADW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 16/78 (21%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 15/85 (18%)

Return to query results.
Submit another query.