DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33752

DIOPT Version :9

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:103 Identity:27/103 - (26%)
Similarity:42/103 - (40%) Gaps:31/103 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LFSTSIDVCNIV-NAAKINLFKKWYKNLLKYGNFLRQCPLNASHYY---------LRDWQFGEGL 145
            ||:.::|.|:.: :...:|:|..:|..:..|.||...||.|.|..|         |.|..|.:  
  Fly    87 LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAK-- 149

  Fly   146 VPPFITSGSYR--------------LETY---NFFGKY 166
            :|  :.:|:|.              |.||   |...||
  Fly   150 IP--LPTGNYMFSIKLATDDVWRVVLNTYFDVNVENKY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 27/103 (26%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 21/75 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.