DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33927

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:179 Identity:39/179 - (21%)
Similarity:62/179 - (34%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISQLARLEIPLCLAIALFSIRAEGSVKFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRG 71
            :|.:..|.:...:|:.|.||.|          |||.   |.||.....|:........|...:|.
  Fly     4 VSNVLYLVLFFRIALELGSINA----------SRFK---FTNFVCDSVNETWLAVHQCRLKAIRR 55

  Fly    72 WRARLDFRTRV--------------GNSKSFQS-LFSTSIDVCNIV----NAAKINLFKKWYKNL 117
            ....|.|...|              ..:..|:. |::.:.|.|..:    .|..|.:|     ||
  Fly    56 GTTTLSFNGTVLKTISKFRVHGQIFKRANGFKPWLYNITFDGCRFLRKPYEAPVIIVF-----NL 115

  Fly   118 LK-YGNFLRQCPLNASHYYLRDWQFGEGLVPPFITSGSYRLETYNFFGK 165
            || :.|....||.....:.:.....||.:..| :.:|.|.::...:..|
  Fly   116 LKSFSNLNFTCPYMGPVHIMGLHIIGEQIPVP-LPTGEYLIQIKWYISK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 20/84 (24%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 19/85 (22%)

Return to query results.
Submit another query.