powered by:
Protein Alignment CG33770 and CG33689
DIOPT Version :9
Sequence 1: | NP_001027144.2 |
Gene: | CG33770 / 3772256 |
FlyBaseID: | FBgn0053770 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027132.2 |
Gene: | CG33689 / 3771798 |
FlyBaseID: | FBgn0053689 |
Length: | 178 |
Species: | Drosophila melanogaster |
Alignment Length: | 34 |
Identity: | 9/34 - (26%) |
Similarity: | 13/34 - (38%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 SIDVCNIVNAAKINLFKKWYKNLLKYGNFLRQCP 128
:.|.|..:...|..:.|.:||......|....||
Fly 88 TFDGCKFLRNQKHPIIKLFYKIYQGSSNINHTCP 121
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33770 | NP_001027144.2 |
DM8 |
88..178 |
CDD:214778 |
9/34 (26%) |
CG33689 | NP_001027132.2 |
DUF1091 |
73..153 |
CDD:284008 |
9/34 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.