DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG14492

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:117 Identity:26/117 - (22%)
Similarity:50/117 - (42%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSLFSTSID 97
            :|..|.|:..::...:..|.:.......|.:::..|.|. |...||           .|.:.:.|
  Fly    53 EFTCGISKSTKRRTWHMEFVLEQPVAEHDFFIKIVLPRR-RPLPDF-----------VLLNVTTD 105

  Fly    98 VCNIV-NAAKINLFKKWYKNLLKYGNFLRQCPLNASH-YYLRDWQFGEGLVP 147
            .|.:: |..::.|.:.....:.::.||.:|||...:. ||:|.::....|||
  Fly   106 GCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 16/62 (26%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 18/74 (24%)

Return to query results.
Submit another query.