DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33476

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:58/136 - (42%) Gaps:14/136 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAEGSVKFIAGESRFNRKYFENFTFTIRNDKIFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSL 91
            |..|..|||......:..:  ||..........:|:|..:.:.......:||..||..:|  :.:
  Fly    12 RFRGGSKFIMESLATSCDH--NFVEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTK--RVM 72

  Fly    92 FST-SIDVCN-IVNAAKINLFKKWYKNLLKYGNFLRQCPLNASHYYLRDWQFGEG---LVPPFIT 151
            :.. :.|.|. ::|.....:|...||.|:..|:|. .||:....||:|:    ||   ::|.|..
  Fly    73 YKVDNFDGCQFLMNPLMNRVFGTVYKRLVVNGSFF-SCPIKPGVYYIRN----EGSVAMLPVFQP 132

  Fly   152 SGSYRL 157
            .|.|::
  Fly   133 PGRYQI 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 20/75 (27%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 25/87 (29%)

Return to query results.
Submit another query.