DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33770 and CG33477

DIOPT Version :10

Sequence 1:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:196 Identity:43/196 - (21%)
Similarity:75/196 - (38%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCLAIALF--------SIRAEGSVKFIA-----GESRFNRKYFENFTFTIRNDKIFLDMYLRKPL 68
            |||...||        |:.....||::.     ...|.|.:|... :...|.|..|::.:.|.| 
  Fly    11 LCLFGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLE-SLDTRCDHDFVEYFHRVP- 73

  Fly    69 VRGWRARLDFRTRVGNSKSFQSLFSTSIDV-----------------CNIVNAAKI-NLFKKWYK 115
                .:::.:..||   ......|:.:|.:                 |..:|...| .:|.:.||
  Fly    74 ----DSKILYTFRV---VKLAPAFTINITIKVLKTHRIMYKIENFKGCEFLNNPVIFKMFGESYK 131

  Fly   116 NLLKYGNFLRQCPLNASHYYLRDWQFGEGL------VPPFITSGSYRLETYNFFGKYKGKDEDFI 174
            .|:..|::.: ||:..:.|||:.    :|:      |.||   |.::|   :...|.|...:.|:
  Fly   132 TLVVNGSYFK-CPIKPNVYYLKT----DGIMSMIPSVHPF---GRFQL---SMRVKMKESRKPFV 185

  Fly   175 M 175
            |
  Fly   186 M 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33770NP_001027144.2 DM8 88..178 CDD:214778 25/112 (22%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 18/78 (23%)

Return to query results.
Submit another query.