DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33898 and H2BC17

DIOPT Version :9

Sequence 1:NP_001027310.1 Gene:His2B:CG33898 / 3772248 FlyBaseID:FBgn0053898 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_003518.2 Gene:H2BC17 / 8348 HGNCID:4758 Length:126 Species:Homo sapiens


Alignment Length:129 Identity:105/129 - (81%)
Similarity:108/129 - (83%) Gaps:9/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAG-----KAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSI 59
            || |..|..|.||..     ||||   |..||:||.|||||:||:||||||||||||||||||.|
Human     1 MPDPAKSAPAPKKGSKKAVTKAQK---KDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGI 62

  Fly    60 MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |||||||||||||.||||||||||||||||||||||||||||||||||||||||||||||||||
Human    63 MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33898NP_001027310.1 H2B 33..121 CDD:197718 83/87 (95%)
H2BC17NP_003518.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 16/36 (44%)
H2B 28..124 CDD:197718 89/95 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4650
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3871
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm40568
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - LDO PTHR23428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2558
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.