DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33898 and AT5G02570

DIOPT Version :9

Sequence 1:NP_001027310.1 Gene:His2B:CG33898 / 3772248 FlyBaseID:FBgn0053898 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_195877.1 Gene:AT5G02570 / 831878 AraportID:AT5G02570 Length:132 Species:Arabidopsis thaliana


Alignment Length:132 Identity:90/132 - (68%)
Similarity:102/132 - (77%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGKAAKK--AGKAQKNITK--------TDKKKKRKRKESYAIYIYKVLKQVHPDTGISSK 55
            |.||...|.|:|  |.||:|.|.|        ..|||.:|..|:|.|||:|||||||||.|||.|
plant     1 MAPKAEKKPAEKAPAPKAEKKIAKEGGTSEIVKKKKKTKKSTETYKIYIFKVLKQVHPDIGISGK 65

  Fly    56 AMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT 120
            ||.|||||:|||||::|.|:||||.|||:.|||||||||||||:|||||||||||||||||||:|
plant    66 AMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 130

  Fly   121 SS 122
            ||
plant   131 SS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33898NP_001027310.1 H2B 33..121 CDD:197718 71/87 (82%)
AT5G02570NP_195877.1 H2B 47..131 CDD:197718 69/83 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1804
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1530
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm2531
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.