DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33898 and HTB11

DIOPT Version :10

Sequence 1:NP_001027310.1 Gene:His2B:CG33898 / 3772248 FlyBaseID:FBgn0053898 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_190189.1 Gene:HTB11 / 823746 AraportID:AT3G46030 Length:145 Species:Arabidopsis thaliana


Alignment Length:132 Identity:90/132 - (68%)
Similarity:105/132 - (79%) Gaps:11/132 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPKTSGKA----AKKAGKAQKNITKT-----DKKKKRKRK--ESYAIYIYKVLKQVHPDTGISSK 55
            |.:...||    |:|..||.|.:.|.     |||||.|:|  |:|.|||:|||||||||.|||||
plant    14 PVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSK 78

  Fly    56 AMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT 120
            ||.|||||:|||||::|:|:|:||.|||:.|||||||||||||:|||||||||||||||||||:|
plant    79 AMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT 143

  Fly   121 SS 122
            ||
plant   144 SS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33898NP_001027310.1 HFD_H2B 33..120 CDD:467035 71/86 (83%)
HTB11NP_190189.1 HFD_H2B 56..143 CDD:467035 71/86 (83%)

Return to query results.
Submit another query.