DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33898 and his-39

DIOPT Version :10

Sequence 1:NP_001027310.1 Gene:His2B:CG33898 / 3772248 FlyBaseID:FBgn0053898 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_505201.3 Gene:his-39 / 191681 WormBaseID:WBGene00001913 Length:67 Species:Caenorhabditis elegans


Alignment Length:67 Identity:62/67 - (92%)
Similarity:66/67 - (98%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS 121
            ||||||||||:||||||||||||||||||||:||||||||||:|||||||:||||||.|||||||
 Worm     1 MSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKNAVSEGTNAVTKYTS 65

  Fly   122 SK 123
            ||
 Worm    66 SK 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33898NP_001027310.1 HFD_H2B 33..120 CDD:467035 57/62 (92%)
his-39NP_505201.3 HFD_H2B <1..64 CDD:467035 57/62 (92%)

Return to query results.
Submit another query.