DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33898 and H2BW1

DIOPT Version :9

Sequence 1:NP_001027310.1 Gene:His2B:CG33898 / 3772248 FlyBaseID:FBgn0053898 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001002916.4 Gene:H2BW1 / 158983 HGNCID:27252 Length:147 Species:Homo sapiens


Alignment Length:116 Identity:51/116 - (43%)
Similarity:73/116 - (62%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QKNITKTDKKKKRKRK--------------ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDI 67
            :.|.|.:.|:.|::::              :|:|.|..:||||||....:|.:|:|:|:|.|:||
Human    21 EANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDI 85

  Fly    68 FERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK 118
            .:|||.||..||...||.|||:.|.:.||||||||::.|.|.|||||||.:
Human    86 LDRIATEAGHLARSTKRQTITAWETRMAVRLLLPGQMGKLAESEGTKAVLR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33898NP_001027310.1 H2B 33..121 CDD:197718 47/86 (55%)
H2BW1NP_001002916.4 H2B 25..138 CDD:355063 50/112 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.