DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp7

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_110459.1 Gene:Fabp7 / 80841 RGDID:69312 Length:132 Species:Rattus norvegicus


Alignment Length:110 Identity:55/110 - (50%)
Similarity:73/110 - (66%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :||..|:|||||||.||||..||::||...|||.::.||....:.|..|||.:.|||:||.||:|
  Rat     9 WKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEISFQLGEEFEE 73

  Fly    73 ETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELITLI 116
            .::|.||.||:|.|||:||...||.| |.|..|||..|.:::..:
  Rat    74 TSIDDRNCKSVIRLDGDKLIHVQKWDGKETNCVREIKDGKMVVTL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 53/99 (54%)
Fabp7NP_110459.1 lipocalin_FABP 2..131 CDD:415860 55/110 (50%)
Fatty acid binding. /evidence=ECO:0000250 127..129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I5967
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37880
Inparanoid 1 1.050 118 1.000 Inparanoid score I4699
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm45100
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.