DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp4

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_038959127.1 Gene:Fabp4 / 79451 RGDID:69309 Length:142 Species:Rattus norvegicus


Alignment Length:130 Identity:65/130 - (50%)
Similarity:81/130 - (62%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66
            :||| .:||..|||||:||||:|||..|||:.....|.:.:::|||...:.:.||||.:.|||||
  Rat     4 AFVG-TWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNLIISVEGDLVVIRSESTFKNTEISFKL 67

  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELITL--IPHLT----PSQH 124
            ||||||.|.|.|.|||||||||..|...||.| |.|||.|....::|:.:  ..||.    |..|
  Rat    68 GVEFDEITPDDRKVKSIITLDGGVLVHVQKWDGKSTTIKRRRDGDKLVVVSYAAHLAVLSGPQDH 132

  Fly   125  124
              Rat   133  132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 57/100 (57%)
Fabp4XP_038959127.1 lipocalin_FABP 2..116 CDD:415860 61/112 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350732
Domainoid 1 1.000 113 1.000 Domainoid score I5967
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4699
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm45100
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.