DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Fabp3

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_077076.1 Gene:Fabp3 / 79131 RGDID:69048 Length:133 Species:Rattus norvegicus


Alignment Length:118 Identity:62/118 - (52%)
Similarity:80/118 - (67%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKL 66
            :||| .:||..|:|||:|||.||||..||::.:...||..:...|||.|:.|.||||.:.|||:|
  Rat     4 AFVG-TWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQL 67

  Fly    67 GVEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELITLIPH 118
            ||||||.|.|.|.|||::||||.||...||.| :.||:.||.:|.:||..:.|
  Rat    68 GVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 54/100 (54%)
Fabp3NP_077076.1 FABP3 4..131 CDD:381241 62/118 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350733
Domainoid 1 1.000 113 1.000 Domainoid score I5967
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4699
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm45100
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X240
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.