DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and FABP12

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001098751.1 Gene:FABP12 / 646486 HGNCID:34524 Length:140 Species:Homo sapiens


Alignment Length:107 Identity:49/107 - (45%)
Similarity:66/107 - (61%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :|....||.::||||||:|..:||:|....|||.::.:||..|:.|.|.||.:.||||||.||:|
Human     9 WKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEE 73

  Fly    73 ETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .|..|...||.:|||...|.|.|..| |.|||.|:..|.:::
Human    74 ITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 48/99 (48%)
FABP12NP_001098751.1 Lipocalin 6..131 CDD:278490 49/107 (46%)
Fatty acid binding. /evidence=ECO:0000250 127..129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156797
Domainoid 1 1.000 115 1.000 Domainoid score I6016
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4779
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm40966
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.