DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and FABP12

DIOPT Version :10

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001098751.1 Gene:FABP12 / 646486 HGNCID:34524 Length:140 Species:Homo sapiens


Alignment Length:107 Identity:49/107 - (45%)
Similarity:66/107 - (61%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :|....||.::||||||:|..:||:|....|||.::.:||..|:.|.|.||.:.||||||.||:|
Human     9 WKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEEFEE 73

  Fly    73 ETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .|..|...||.:|||...|.|.|..| |.|||.|:..|.:::
Human    74 ITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 FABP_pancrustacea 2..116 CDD:381252 49/107 (46%)
FABP12NP_001098751.1 lipocalin_FABP 4..131 CDD:471979 49/107 (46%)

Return to query results.
Submit another query.