DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and Rbp7

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006539148.1 Gene:Rbp7 / 63954 MGIID:1890409 Length:173 Species:Mus musculus


Alignment Length:80 Identity:27/80 - (33%)
Similarity:46/80 - (57%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDEET--LDGRNVKSII 84
            :..:...|||:...|.|...:...||::|:.|.|:.:...:.||:|.||:|:.  ||.|...|::
Mouse    62 QCSIDFATRKIAKLLKPQKVIEQNGDSFTIQTCSSLRNYLVKFKVGEEFEEDNKGLDNRKCTSLV 126

  Fly    85 TLDGNKLTQEQKGDK 99
            |.:.:|||..|:|:|
Mouse   127 TWENDKLTCVQRGEK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 27/80 (34%)
Rbp7XP_006539148.1 lipocalin_FABP 65..173 CDD:385686 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847210
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.