DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and RBP2

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_004155.2 Gene:RBP2 / 5948 HGNCID:9920 Length:134 Species:Homo sapiens


Alignment Length:110 Identity:40/110 - (36%)
Similarity:68/110 - (61%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            ::::.:|||:.|||.|.:...|||:...|:.|..:..:||.:...|||||:...:.|.:||||||
Human     9 WEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDE 73

  Fly    73 ET--LDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELITL 115
            .|  ||.|:||:::|.:|:.|...|||:|.....:::.:.:.:.|
Human    74 YTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 39/100 (39%)
RBP2NP_004155.2 Lipocalin 6..122 CDD:306552 40/110 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.