DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and fabp7a

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_571680.1 Gene:fabp7a / 58128 ZFINID:ZDB-GENE-000627-1 Length:132 Species:Danio rerio


Alignment Length:107 Identity:56/107 - (52%)
Similarity:74/107 - (69%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDE 72
            :||..|:|||||||.||||..||::||...||:.::.|||...:.|.||||.:.||||||.||||
Zfish     9 WKLVDSQNFDEYMKSLGVGFATRQVGNVTKPTIVISHEGDKVVIKTLSTFKNTEISFKLGEEFDE 73

  Fly    73 ETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .|.|.|:|||.::|:|:.|.|.|:.| |.|..|||..|.:::
Zfish    74 TTADDRHVKSTVSLEGDNLVQVQRWDGKETKFVREIKDGKMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 54/99 (55%)
fabp7aNP_571680.1 Lipocalin 8..132 CDD:278490 56/107 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5707
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4730
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm24858
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.