DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and fabp3

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001015823.1 Gene:fabp3 / 548540 XenbaseID:XB-GENE-974423 Length:131 Species:Xenopus tropicalis


Alignment Length:112 Identity:52/112 - (46%)
Similarity:73/112 - (65%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            |.| .::|.:|:|||||||.||||..||::||...||..::|:||...:.|.||||.:.:||||.
 Frog     4 FAG-TWRLVESKNFDEYMKGLGVGFATRQIGNVTKPTTIISLDGDKVKVQTQSTFKNTEVSFKLN 67

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .||||.|.|.|..||.:|::..|:...||.| |.|.::||...::|:
 Frog    68 EEFDECTADDRKCKSFVTIEDGKMKHVQKWDGKETILIREVDGDKLV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 48/100 (48%)
fabp3NP_001015823.1 lipocalin_FABP 4..130 CDD:385686 52/112 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8227
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.