DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and PMP2

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_002668.1 Gene:PMP2 / 5375 HGNCID:9117 Length:132 Species:Homo sapiens


Alignment Length:112 Identity:59/112 - (52%)
Similarity:76/112 - (67%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLG 67
            |:| .:||..|||||:|||.|||||.|||:||...|||.::.:||..|:.|.||||.:.||||||
Human     5 FLG-TWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLG 68

  Fly    68 VEFDEETLDGRNVKSIITLDGNKLTQEQKGD-KPTTIVREFTDNELI 113
            .||:|.|.|.|..|||:||....|.|.|:.| |.|||.|:..:.:::
Human    69 QEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 57/100 (57%)
PMP2NP_002668.1 FABP8 3..131 CDD:381244 59/112 (53%)
Fatty acid binding 127..129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156803
Domainoid 1 1.000 115 1.000 Domainoid score I6016
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4779
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45877
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000407
OrthoInspector 1 1.000 - - otm40966
orthoMCL 1 0.900 - - OOG6_102739
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X240
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.