DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fabp and crabp2b

DIOPT Version :9

Sequence 1:NP_001027179.1 Gene:fabp / 3772232 FlyBaseID:FBgn0037913 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001307323.1 Gene:crabp2b / 503502 ZFINID:ZDB-GENE-050208-52 Length:146 Species:Danio rerio


Alignment Length:114 Identity:40/114 - (35%)
Similarity:72/114 - (63%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YKLDKSENFDEYMKELGVGLVTRKMGNSLS--PTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEF 70
            :|:..||||:|.:|.|||.:..||:..:.:  |.||::.:|::.::.|:::.:|:.:||.:|..|
Zfish    16 WKMKSSENFEELLKALGVNVFLRKIAVAAASKPAVEISQQGESLSVQTSTSVRTTHVSFTVGESF 80

  Fly    71 DEETLDGRNVKSIITLDGN-KLTQE---QKGDKP-TTIVREFT-DNELI 113
            :|.|:|||...|....:.: |::.|   |||:.| |:..||.| |.::|
Zfish    81 NETTVDGRPCTSFPKWETDCKISCEQTLQKGEGPETSWTRELTNDGQMI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fabpNP_001027179.1 Lipocalin 7..>107 CDD:278490 36/105 (34%)
crabp2bNP_001307323.1 Lipocalin 13..146 CDD:278490 40/114 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592451
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4015
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11955
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.